General Information

  • ID:  hor004185
  • Uniprot ID:  Q9TSZ0(25-34)
  • Protein name:  Angiotensin-1
  • Gene name:  AGT
  • Organism:  Callithrix jacchus (White-tufted-ear marmoset)
  • Family:  Serpin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Callithrix (subgenus), Callithrix (genus), Callitrichinae (subfamily), Cebidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004867 serine-type endopeptidase inhibitor activity
  • GO BP:  GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin; GO:0010718 positive regulation of epithelial to mesenchymal transition; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance; GO:1901394 positive regulation of transforming growth factor beta1 activation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DRVYIHPFHL
  • Length:  10(25-34)
  • Propeptide:  MPPASMSLRVTILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEELAKANAGKPEDPTFTPALIQAKSLPVDEKALQDQLVLVAAKLNAEDKLRAATVGMLANFLSFHIYSMHSELWGMVQGATILSPMAVFGTLASLYLGASNHTAYRLQAILGVPWKDENCTSRLDAHKVLSALQAVQGLLVAQDRAEGQTQLLLSTVVGLFTAPGLHLKQPFVQGLALYAPAVLPRSLDFSTDLDVAAEKIDRFMQAVTGWKV
  • Signal peptide:  MPPASMSLRVTILCLLAWAGLAAG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  AGTR2
  • Target Unid:  F6Q2S1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 1 hours; /3600 seconds ( PubMed ID: 22186872 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TSZ0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004185_AF2.pdbhor004185_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 145721 Formula: C62H89N17O14
Absent amino acids: ACEGKMNQSTW Common amino acids: H
pI: 7.71 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -20 Boman Index: -1624
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 107
Instability Index: 2264 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  10598135##22186872
  • Title:  Cloning and Characterization of Marmoset Renin: Comparison With Human Renin